Online shopping for Home Supplies with free shipping

- drhomely.com

Great selection of Home Supplies at affordable prices! Free shipping to 185 countries. 45 days money back guarantee. Friendly customer service.

Not Applicable $ 8.95


Online shopping for Bedding & Sleeping Supplies with free shipping

- cozysleeptoday.com

Great selection of Bedding & Sleeping Supplies at affordable prices! Free shipping to 185 countries. 45 days money back guarantee. Friendly customer service.

Not Applicable $ 8.95

Doggieolympicgames - Online Shopping for Popular Lights & Lighting, La

- doggieolympicgames.com

Doggieolympicgames - Online Shopping for the Latest Lights & Lighting, Lamps & Shades, Ceiling Lights & Fans, Light Bulbs, LED Lighting, Outdoor Lighting, LED Lamps, Portable Lighting, Commercial Lighting, Night Lights, Book Lights, Professional Lighting, Novelty Lighting, Holiday Lighting, Lighting Accessories, Under

Not Applicable $ 8.95

PermaGLO Safety Lighting Products

- wayfinder.us

PermaGLO Lighting is committed to their development of the next generation of energy-efficient and maintenance-free lighting products that provide an attractive and safer environment using Light Emitting Diodes.

Not Applicable $ 8.95

Ningbo TopLite Electronic Technology Co.,Ltd. TopLite Everyday use pro

- toplite.us

Ningbo TopLite Electronic Technology Co.,Ltd. TopLite Everyday use products such as Sensor Lamp, Solar montion lamp,LED flashlights,Headlamp, lanterns,Night lights, work lights, wall lights, solar sensor lights, garden light, emergency kits and multitools with everyday safety functions. Browse our gear that fits your l

Not Applicable $ 8.95

Nlnp - Online Shopping for Popular Lights & Lighting, Lamps & Shades,

- nlnp.net

Nlnp - Online Shopping for the Latest Lights & Lighting, Lamps & Shades, Ceiling Lights & Fans, Light Bulbs, LED Lighting, Outdoor Lighting, LED Lamps, Portable Lighting, Commercial Lighting, Night Lights, Book Lights, Professional Lighting, Novelty Lighting, Holiday Lighting, Lighting Accessories, Under Cabinet Lights

Not Applicable $ 8.95

Buy High-Quality Products for Good and Healthy Sleep online

- yourcomfortshop.com

Great selection of Products for Good and Healthy Sleep at affordable prices! Free shipping to 185 countries. 45 days money back guarantee. Friendly customer service.

Not Applicable $ 8.95

Cleveland Electrical Services | AC Electric

- electricalservicescleveland.com

With its beautiful skyline along the lake, we have provided Cleveland electrical services such as installing landscape lights to accent homes; assisted property

Not Applicable $ 8.95

Atlantic Fragrances, Inc.

- oilsandincense.com

Scented oils, incense, oil burners, night light oil burners.

Not Applicable $ 8.95

UPCYCLED Liquor Wine and OTHER glass Bottle by AuroraBottleLights

- aurorabottlelights.com

Browse unique items from AuroraBottleLights on Etsy, a global marketplace of handmade, vintage and creative goods.

Not Applicable $ 8.95

Handpicked gifts for children all for £10 or under .... Shhhhh!

- 10littlebirds.com

A selection of handpicked childrens' gifts all for £10.00 or less, from colouring books, craft kits, and cutlery sets through to sticker books, soft toys and night lights

23,454,341 $ 8.95

Leviton manufacturing Products, Online Wholesaler www.sasanelectricals

- sasanelectricals.com

Welcome to the All Products section of the Leviton online Distributer Web Site, a leading South California distributer of electrical and electronic products.

6,217,427 $ 240.00

artconnectedgroup.com - HOME/Photo & Embroidered Gift Items (Below):

- loveyoblanket.com

Photo Gifts, Custom gifts, Personalization, Embroidery

Not Applicable $ 8.95

SarahJadeCreations on Etsy

- sarahjadecreations.com

At Sarah Jade Creations, we offer a variety of items personalized with high quality vinyl. Mugs, hair brushes, cutting boards, keychains,

Not Applicable $ 8.95

Smores Ornaments - Solmate Socks - Suzy Toronto - Denali Throws - Blan

- smoresornaments.com

Flying Cloud Gifts has a wide array of gift ideas, including Thames & Kosmos Science labs, Christmas wreaths made in Oregon, American Dakota National Park rugs, Denali Throws, Socklady Socks, Serenity Angels ornaments and much more. We make fresh Christmas Wreaths, and purchase items mostly made in America, American Ma

Not Applicable $ 8.95

GotTheLight?

- gotthelight.com

Be part of something special! Christians around the world know what the Light is … We want people that do not know to ask you … What is the Light? Our goal is simple. To spread the Word through an image created for Him by Him. We already have the web site domain www.GotTheLight.com and intend to market this image a

Not Applicable $ 8.95

Rocky River Electrical Service | AC Electric

- electricalservicesrockyrivercom.com

Being neighbors to Lakewood and Fairview Park, it's no wonder AC Electric has been providing Rocky River electrical service since 1999!

Not Applicable $ 8.95

Fairview Park Electrical Services | AC Electric

- electricalservicesfairviewpark.com

Fairview Park electrical services and violation corrections is something AC Electric specializes in. Give us a call now to see how we can be of service to you;

Not Applicable $ 8.95

Ella Musher-Eizenman | Redbubble

- ellasphotostudio.com

https://www.facebook.com/ellamusheresphotography/

Not Applicable $ 8.95

Akron Electrical Services | AC Electric

- electricalservicesakron.com

With the many factories and warehouses, we have offered Akron electrical services to owners and property managers; and, have assisted them realize a significant

Not Applicable $ 8.95


Rocky River Electrical Service | AC Electric

- electricalcontractorsrockyriver.com

Being neighbors to Lakewood and Fairview Park, it's no wonder AC Electric has been providing Rocky River electrical service since 1999!

Not Applicable $ 8.95